Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1592154..1592799 | Replicon | chromosome |
Accession | NZ_CP103808 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | toxT | Uniprot ID | - |
Locus tag | NYR61_RS07350 | Protein ID | WP_279456935.1 |
Coordinates | 1592428..1592799 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR61_RS07345 | Protein ID | WP_279468297.1 |
Coordinates | 1592154..1592447 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR61_RS07315 (NYR61_07315) | 1587486..1588169 | - | 684 | WP_279456929.1 | arginine ABC transporter permease ArtM | - |
NYR61_RS07320 (NYR61_07320) | 1588169..1588840 | - | 672 | WP_005598470.1 | arginine ABC transporter permease ArtQ | - |
NYR61_RS07325 (NYR61_07325) | 1588846..1589565 | - | 720 | WP_279468293.1 | transporter substrate-binding domain-containing protein | - |
NYR61_RS07330 (NYR61_07330) | 1589586..1590320 | - | 735 | WP_279468294.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR61_RS07335 (NYR61_07335) | 1590545..1591042 | - | 498 | WP_279468295.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR61_RS07340 (NYR61_07340) | 1591115..1592077 | + | 963 | WP_279468296.1 | calcium/sodium antiporter | - |
NYR61_RS07345 (NYR61_07345) | 1592154..1592447 | - | 294 | WP_279468297.1 | helix-turn-helix domain-containing protein | Antitoxin |
NYR61_RS07350 (NYR61_07350) | 1592428..1592799 | - | 372 | WP_279456935.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR61_RS07355 (NYR61_07355) | 1593003..1594751 | + | 1749 | WP_279468298.1 | protein-disulfide reductase DsbD | - |
NYR61_RS07360 (NYR61_07360) | 1594811..1595380 | + | 570 | WP_279468299.1 | elongation factor P hydroxylase | - |
NYR61_RS07365 (NYR61_07365) | 1595424..1596279 | - | 856 | Protein_1430 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15024.49 Da Isoelectric Point: 10.2796
>T256692 WP_279456935.1 NZ_CP103808:c1592799-1592428 [Actinobacillus genomosp. 1]
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|