Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 1853158..1853734 | Replicon | chromosome |
Accession | NZ_CP103807 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR60_RS09260 | Protein ID | WP_279466916.1 |
Coordinates | 1853423..1853734 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR60_RS09255 | Protein ID | WP_279445789.1 |
Coordinates | 1853158..1853442 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR60_RS09225 (NYR60_09225) | 1848519..1849202 | - | 684 | WP_279466905.1 | arginine ABC transporter permease ArtM | - |
NYR60_RS09230 (NYR60_09230) | 1849202..1849873 | - | 672 | WP_279466907.1 | arginine ABC transporter permease ArtQ | - |
NYR60_RS09235 (NYR60_09235) | 1849879..1850598 | - | 720 | WP_279466909.1 | transporter substrate-binding domain-containing protein | - |
NYR60_RS09240 (NYR60_09240) | 1850618..1851352 | - | 735 | WP_279466911.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR60_RS09245 (NYR60_09245) | 1851560..1852057 | - | 498 | WP_279466913.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR60_RS09250 (NYR60_09250) | 1852131..1853093 | + | 963 | WP_279466915.1 | calcium/sodium antiporter | - |
NYR60_RS09255 (NYR60_09255) | 1853158..1853442 | - | 285 | WP_279445789.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR60_RS09260 (NYR60_09260) | 1853423..1853734 | - | 312 | WP_279466916.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR60_RS09265 (NYR60_09265) | 1853991..1855739 | + | 1749 | WP_279466918.1 | protein-disulfide reductase DsbD | - |
NYR60_RS09270 (NYR60_09270) | 1855798..1856367 | + | 570 | WP_279466920.1 | elongation factor P hydroxylase | - |
NYR60_RS09275 (NYR60_09275) | 1856411..1857265 | - | 855 | WP_279466922.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12303.29 Da Isoelectric Point: 10.3989
>T256690 WP_279466916.1 NZ_CP103807:c1853734-1853423 [Actinobacillus genomosp. 2]
VGLLKQSHNDNREKLQKISHHLSILHLHGTRAGENYIKHLEDRIWQIRPMSDCLLLTSIIRGQFVLLHYLAKSHYRIPKR
EIERAKSRLADLQARIKDEPYWF
VGLLKQSHNDNREKLQKISHHLSILHLHGTRAGENYIKHLEDRIWQIRPMSDCLLLTSIIRGQFVLLHYLAKSHYRIPKR
EIERAKSRLADLQARIKDEPYWF
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|