Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1424062..1424690 | Replicon | chromosome |
Accession | NZ_CP103807 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYR60_RS07145 | Protein ID | WP_279466397.1 |
Coordinates | 1424062..1424460 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYR60_RS07150 | Protein ID | WP_279466398.1 |
Coordinates | 1424460..1424690 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR60_RS07130 (NYR60_07130) | 1419273..1420448 | - | 1176 | WP_279466390.1 | hypothetical protein | - |
NYR60_RS07135 (NYR60_07135) | 1420451..1421662 | - | 1212 | WP_279466392.1 | alpha-2,8-polysialyltransferase family protein | - |
NYR60_RS07140 (NYR60_07140) | 1422042..1423706 | + | 1665 | WP_279466395.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NYR60_RS07145 (NYR60_07145) | 1424062..1424460 | - | 399 | WP_279466397.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NYR60_RS07150 (NYR60_07150) | 1424460..1424690 | - | 231 | WP_279466398.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NYR60_RS07155 (NYR60_07155) | 1424765..1424938 | + | 174 | Protein_1386 | addiction module antidote protein, HigA family | - |
NYR60_RS07160 (NYR60_07160) | 1425328..1426692 | - | 1365 | WP_279466400.1 | NERD domain-containing protein | - |
NYR60_RS07165 (NYR60_07165) | 1426768..1427046 | - | 279 | WP_279466402.1 | hypothetical protein | - |
NYR60_RS07170 (NYR60_07170) | 1427061..1427285 | - | 225 | WP_279466404.1 | hypothetical protein | - |
NYR60_RS07175 (NYR60_07175) | 1427275..1428243 | - | 969 | WP_279466405.1 | hypothetical protein | - |
NYR60_RS07180 (NYR60_07180) | 1428301..1428459 | - | 159 | WP_279466406.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15048.30 Da Isoelectric Point: 6.9788
>T256687 WP_279466397.1 NZ_CP103807:c1424460-1424062 [Actinobacillus genomosp. 2]
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKQGEIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKQGEIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|