Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 561539..562168 | Replicon | chromosome |
| Accession | NZ_CP103807 | ||
| Organism | Actinobacillus genomosp. | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NYR60_RS02710 | Protein ID | WP_279467627.1 |
| Coordinates | 561539..561694 (+) | Length | 52 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NYR60_RS02715 | Protein ID | WP_279467628.1 |
| Coordinates | 561764..562168 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR60_RS02665 (NYR60_02665) | 556743..556946 | + | 204 | WP_279467957.1 | Cro/CI family transcriptional regulator | - |
| NYR60_RS02670 (NYR60_02670) | 556939..557499 | + | 561 | WP_279467619.1 | hypothetical protein | - |
| NYR60_RS02675 (NYR60_02675) | 557593..557805 | + | 213 | WP_279467620.1 | hypothetical protein | - |
| NYR60_RS02680 (NYR60_02680) | 557820..558092 | + | 273 | WP_279467621.1 | hypothetical protein | - |
| NYR60_RS02685 (NYR60_02685) | 558067..558294 | + | 228 | WP_279467622.1 | hypothetical protein | - |
| NYR60_RS02690 (NYR60_02690) | 558285..558509 | + | 225 | WP_279467623.1 | hypothetical protein | - |
| NYR60_RS02695 (NYR60_02695) | 558506..558799 | + | 294 | WP_279467624.1 | hypothetical protein | - |
| NYR60_RS02700 (NYR60_02700) | 558796..561141 | + | 2346 | WP_279467625.1 | replication endonuclease | - |
| NYR60_RS02705 (NYR60_02705) | 561158..561415 | + | 258 | WP_279467626.1 | single-stranded DNA-binding protein | - |
| NYR60_RS02710 (NYR60_02710) | 561539..561694 | + | 156 | WP_279467627.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NYR60_RS02715 (NYR60_02715) | 561764..562168 | + | 405 | WP_279467628.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NYR60_RS02720 (NYR60_02720) | 562200..562475 | - | 276 | WP_279467629.1 | ogr/Delta-like zinc finger family protein | - |
| NYR60_RS02725 (NYR60_02725) | 562548..563561 | - | 1014 | WP_279467958.1 | phage portal protein | - |
| NYR60_RS02730 (NYR60_02730) | 563579..565384 | - | 1806 | WP_279467630.1 | terminase family protein | - |
| NYR60_RS02735 (NYR60_02735) | 565591..566475 | + | 885 | WP_279467631.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 546175..614946 | 68771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5786.75 Da Isoelectric Point: 10.6682
>T256686 WP_279467627.1 NZ_CP103807:561539-561694 [Actinobacillus genomosp. 2]
MIIADGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGLA
MIIADGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGLA
Download Length: 156 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14965.03 Da Isoelectric Point: 4.2611
>AT256686 WP_279467628.1 NZ_CP103807:561764-562168 [Actinobacillus genomosp. 2]
MFYVVCLEKVSDGYVVSVPDVPGCFSAGDTFAEALHNVKEAIAFHIEGMLEDGEEIPQPQDLEVHLNNPEYQGLLFSGVE
VDLTYLMGKSEKINVTLPSLLIRRIDELVARNPEYKTRSGFLAQIATERIFTQS
MFYVVCLEKVSDGYVVSVPDVPGCFSAGDTFAEALHNVKEAIAFHIEGMLEDGEEIPQPQDLEVHLNNPEYQGLLFSGVE
VDLTYLMGKSEKINVTLPSLLIRRIDELVARNPEYKTRSGFLAQIATERIFTQS
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|