Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 561539..562168 Replicon chromosome
Accession NZ_CP103807
Organism Actinobacillus genomosp.

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NYR60_RS02710 Protein ID WP_279467627.1
Coordinates 561539..561694 (+) Length 52 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NYR60_RS02715 Protein ID WP_279467628.1
Coordinates 561764..562168 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR60_RS02665 (NYR60_02665) 556743..556946 + 204 WP_279467957.1 Cro/CI family transcriptional regulator -
NYR60_RS02670 (NYR60_02670) 556939..557499 + 561 WP_279467619.1 hypothetical protein -
NYR60_RS02675 (NYR60_02675) 557593..557805 + 213 WP_279467620.1 hypothetical protein -
NYR60_RS02680 (NYR60_02680) 557820..558092 + 273 WP_279467621.1 hypothetical protein -
NYR60_RS02685 (NYR60_02685) 558067..558294 + 228 WP_279467622.1 hypothetical protein -
NYR60_RS02690 (NYR60_02690) 558285..558509 + 225 WP_279467623.1 hypothetical protein -
NYR60_RS02695 (NYR60_02695) 558506..558799 + 294 WP_279467624.1 hypothetical protein -
NYR60_RS02700 (NYR60_02700) 558796..561141 + 2346 WP_279467625.1 replication endonuclease -
NYR60_RS02705 (NYR60_02705) 561158..561415 + 258 WP_279467626.1 single-stranded DNA-binding protein -
NYR60_RS02710 (NYR60_02710) 561539..561694 + 156 WP_279467627.1 type II toxin-antitoxin system HicA family toxin Toxin
NYR60_RS02715 (NYR60_02715) 561764..562168 + 405 WP_279467628.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NYR60_RS02720 (NYR60_02720) 562200..562475 - 276 WP_279467629.1 ogr/Delta-like zinc finger family protein -
NYR60_RS02725 (NYR60_02725) 562548..563561 - 1014 WP_279467958.1 phage portal protein -
NYR60_RS02730 (NYR60_02730) 563579..565384 - 1806 WP_279467630.1 terminase family protein -
NYR60_RS02735 (NYR60_02735) 565591..566475 + 885 WP_279467631.1 GPO family capsid scaffolding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 546175..614946 68771


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-50)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5786.75 Da        Isoelectric Point: 10.6682

>T256686 WP_279467627.1 NZ_CP103807:561539-561694 [Actinobacillus genomosp. 2]
MIIADGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGLA

Download         Length: 156 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14965.03 Da        Isoelectric Point: 4.2611

>AT256686 WP_279467628.1 NZ_CP103807:561764-562168 [Actinobacillus genomosp. 2]
MFYVVCLEKVSDGYVVSVPDVPGCFSAGDTFAEALHNVKEAIAFHIEGMLEDGEEIPQPQDLEVHLNNPEYQGLLFSGVE
VDLTYLMGKSEKINVTLPSLLIRRIDELVARNPEYKTRSGFLAQIATERIFTQS

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References