Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-YefM |
| Location | 69273..69940 | Replicon | chromosome |
| Accession | NZ_CP103807 | ||
| Organism | Actinobacillus genomosp. | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NYR60_RS00355 | Protein ID | WP_279467052.1 |
| Coordinates | 69560..69940 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NYR60_RS00350 | Protein ID | WP_279467051.1 |
| Coordinates | 69273..69560 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR60_RS00335 (NYR60_00335) | 64805..65986 | + | 1182 | WP_279467046.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| NYR60_RS00340 (NYR60_00340) | 66040..66588 | + | 549 | WP_279467048.1 | type IV pilus biogenesis/stability protein PilW | - |
| NYR60_RS00345 (NYR60_00345) | 66664..69003 | + | 2340 | WP_279467050.1 | Tex family protein | - |
| NYR60_RS00350 (NYR60_00350) | 69273..69560 | + | 288 | WP_279467051.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NYR60_RS00355 (NYR60_00355) | 69560..69940 | + | 381 | WP_279467052.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYR60_RS00360 (NYR60_00360) | 70049..71329 | - | 1281 | WP_279467986.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NYR60_RS00365 (NYR60_00365) | 71440..71958 | - | 519 | WP_279467053.1 | SprT family zinc-dependent metalloprotease | - |
| NYR60_RS00370 (NYR60_00370) | 71959..72729 | - | 771 | WP_279467054.1 | ribonuclease | - |
| NYR60_RS00375 (NYR60_00375) | 72850..74706 | - | 1857 | WP_279467057.1 | signal peptide peptidase SppA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14524.13 Da Isoelectric Point: 8.4870
>T256685 WP_279467052.1 NZ_CP103807:69560-69940 [Actinobacillus genomosp. 2]
MYLLDTNIVSELLKMESGKADAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPHFENRILPLDTKVMMTCAEF
HIPDKKPLNDSYIAATAKAHRFKIVTRNVKDFKGCGVEVLNPFIDE
MYLLDTNIVSELLKMESGKADAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPHFENRILPLDTKVMMTCAEF
HIPDKKPLNDSYIAATAKAHRFKIVTRNVKDFKGCGVEVLNPFIDE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|