Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 233715..234240 Replicon plasmid pESI_like
Accession NZ_CP103792
Organism Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712

Toxin (Protein)


Gene name ccdB Uniprot ID A0A5Y5FBU7
Locus tag NYQ90_RS23490 Protein ID WP_023994134.1
Coordinates 233935..234240 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A5T8X4Y4
Locus tag NYQ90_RS23485 Protein ID WP_023994135.1
Coordinates 233715..233933 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYQ90_RS23450 (NYQ90_23450) 228747..229511 + 765 WP_023994141.1 minor fimbrial protein -
NYQ90_RS23455 (NYQ90_23455) 229714..230304 + 591 WP_023994140.1 hypothetical protein -
NYQ90_RS23460 (NYQ90_23460) 230406..230582 + 177 WP_230374870.1 FaeA/PapI family transcriptional regulator -
NYQ90_RS23465 (NYQ90_23465) 230843..231004 + 162 WP_001816720.1 hypothetical protein -
NYQ90_RS23470 (NYQ90_23470) 231030..231878 + 849 WP_023994138.1 SdiA-regulated domain-containing protein -
NYQ90_RS23475 (NYQ90_23475) 232448..232864 - 417 WP_223135301.1 type II toxin-antitoxin system VapC family toxin -
NYQ90_RS23480 (NYQ90_23480) 232861..233091 - 231 WP_023994136.1 type II toxin-antitoxin system VapB family antitoxin -
NYQ90_RS23485 (NYQ90_23485) 233715..233933 + 219 WP_023994135.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NYQ90_RS23490 (NYQ90_23490) 233935..234240 + 306 WP_023994134.1 type II toxin-antitoxin system toxin CcdB Toxin
NYQ90_RS23495 (NYQ90_23495) 234242..234532 + 291 WP_023994133.1 hypothetical protein -
NYQ90_RS23500 (NYQ90_23500) 234529..234597 + 69 Protein_238 hypothetical protein -
NYQ90_RS23505 (NYQ90_23505) 234607..234756 + 150 Protein_239 3'-5' exonuclease -
NYQ90_RS23510 (NYQ90_23510) 234875..234991 + 117 Protein_240 hypothetical protein -
NYQ90_RS23515 (NYQ90_23515) 234981..235696 - 716 Protein_241 transposase -
NYQ90_RS23520 (NYQ90_23520) 236978..237514 + 537 WP_023994130.1 fimbrial protein -
NYQ90_RS23525 (NYQ90_23525) 237567..238298 + 732 WP_023994129.1 fimbria/pilus periplasmic chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / faeC / faeD / faeE / faeF / faeH / faeI 1..278481 278481


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11708.47 Da        Isoelectric Point: 6.4685

>T256684 WP_023994134.1 NZ_CP103792:233935-234240 [Salmonella enterica subsp. enterica serovar Infantis]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8261.18 Da        Isoelectric Point: 4.7405

>AT256684 WP_023994135.1 NZ_CP103792:233715-233933 [Salmonella enterica subsp. enterica serovar Infantis]
MKQRITVTIDSDSYQLLKSADVNISGLVNTAMQKEARRLRAERWQAENQEGMAEVARFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y5FBU7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T8X4Y4

References