Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 212441..213198 Replicon plasmid pESI_like
Accession NZ_CP103792
Organism Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag NYQ90_RS23355 Protein ID WP_023994162.1
Coordinates 212716..213198 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag NYQ90_RS23350 Protein ID WP_001195098.1
Coordinates 212441..212725 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYQ90_RS23305 (NYQ90_23305) 208282..208428 - 147 Protein_199 IS66 family insertion sequence element accessory protein TnpB -
NYQ90_RS23310 (NYQ90_23310) 208415..208744 - 330 WP_023994169.1 hypothetical protein -
NYQ90_RS23315 (NYQ90_23315) 208868..209721 + 854 Protein_201 site-specific tyrosine recombinase XerC -
NYQ90_RS23320 (NYQ90_23320) 209690..209977 + 288 WP_031619580.1 damage-inducible protein J -
NYQ90_RS23325 (NYQ90_23325) 209974..210279 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
NYQ90_RS23330 (NYQ90_23330) 211029..211292 + 264 WP_023994165.1 DUF977 family protein -
NYQ90_RS23335 (NYQ90_23335) 211318..211653 + 336 WP_023994164.1 hypothetical protein -
NYQ90_RS23340 (NYQ90_23340) 211875..212072 - 198 Protein_206 PIN domain-containing protein -
NYQ90_RS23345 (NYQ90_23345) 212196..212285 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
NYQ90_RS23350 (NYQ90_23350) 212441..212725 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
NYQ90_RS23355 (NYQ90_23355) 212716..213198 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
NYQ90_RS23360 (NYQ90_23360) 213513..213939 + 427 Protein_210 transposase -
NYQ90_RS23365 (NYQ90_23365) 214256..214465 + 210 WP_023994160.1 hemolysin expression modulator Hha -
NYQ90_RS23370 (NYQ90_23370) 214539..214891 - 353 Protein_212 transposase -
NYQ90_RS23375 (NYQ90_23375) 215118..216091 + 974 Protein_213 IS256 family transposase -
NYQ90_RS23380 (NYQ90_23380) 216093..216335 + 243 WP_023994156.1 hypothetical protein -
NYQ90_RS23385 (NYQ90_23385) 216406..217362 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
NYQ90_RS23390 (NYQ90_23390) 217409..217621 + 213 Protein_216 hypothetical protein -
NYQ90_RS23395 (NYQ90_23395) 217663..217914 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / faeC / faeD / faeE / faeF / faeH / faeI 1..278481 278481
- inside IScluster/Tn - - 206986..219478 12492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T256682 WP_023994162.1 NZ_CP103792:212716-213198 [Salmonella enterica subsp. enterica serovar Infantis]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT256682 WP_001195098.1 NZ_CP103792:212441-212725 [Salmonella enterica subsp. enterica serovar Infantis]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References