Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 198361..198951 | Replicon | plasmid pESI_like |
Accession | NZ_CP103792 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A241PXU0 |
Locus tag | NYQ90_RS23270 | Protein ID | WP_023994178.1 |
Coordinates | 198619..198951 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A5T3Q5H6 |
Locus tag | NYQ90_RS23265 | Protein ID | WP_023994179.1 |
Coordinates | 198361..198618 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ90_RS23245 (NYQ90_23245) | 193861..194885 | + | 1025 | Protein_187 | IS630 family transposase | - |
NYQ90_RS23250 (NYQ90_23250) | 194889..195908 | - | 1020 | WP_223155817.1 | hypothetical protein | - |
NYQ90_RS23255 (NYQ90_23255) | 196048..196554 | - | 507 | WP_223155815.1 | hypothetical protein | - |
NYQ90_RS23260 (NYQ90_23260) | 196665..197750 | - | 1086 | WP_223155813.1 | hypothetical protein | - |
NYQ90_RS23265 (NYQ90_23265) | 198361..198618 | + | 258 | WP_023994179.1 | hypothetical protein | Antitoxin |
NYQ90_RS23270 (NYQ90_23270) | 198619..198951 | + | 333 | WP_023994178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYQ90_RS23275 (NYQ90_23275) | 199551..200156 | + | 606 | Protein_193 | IS481 family transposase | - |
NYQ90_RS23280 (NYQ90_23280) | 200455..202677 | - | 2223 | WP_023994175.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) | fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS / faeC / faeD / faeE / faeF / faeH / faeI | 1..278481 | 278481 | |
- | inside | IScluster/Tn | - | - | 193849..200156 | 6307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11787.54 Da Isoelectric Point: 9.3417
>T256681 WP_023994178.1 NZ_CP103792:198619-198951 [Salmonella enterica subsp. enterica serovar Infantis]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A241PXU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T3Q5H6 |