Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DinJ |
Location | 3965134..3965650 | Replicon | chromosome |
Accession | NZ_CP103791 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A623NIH5 |
Locus tag | NYQ90_RS19085 | Protein ID | WP_023993574.1 |
Coordinates | 3965134..3965418 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A633LVJ8 |
Locus tag | NYQ90_RS19090 | Protein ID | WP_023993575.1 |
Coordinates | 3965408..3965650 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ90_RS19070 (3960250) | 3960250..3961902 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
NYQ90_RS19075 (3962311) | 3962311..3964449 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NYQ90_RS19080 (3964666) | 3964666..3965130 | + | 465 | WP_023993573.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NYQ90_RS19085 (3965134) | 3965134..3965418 | - | 285 | WP_023993574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYQ90_RS19090 (3965408) | 3965408..3965650 | - | 243 | WP_023993575.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NYQ90_RS19095 (3965728) | 3965728..3967641 | - | 1914 | WP_023993576.1 | BglG family transcription antiterminator | - |
NYQ90_RS19100 (3967658) | 3967658..3968398 | - | 741 | WP_023993577.1 | KDGP aldolase family protein | - |
NYQ90_RS19105 (3968395) | 3968395..3969513 | - | 1119 | WP_023993578.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NYQ90_RS19110 (3969497) | 3969497..3970630 | - | 1134 | WP_023993579.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10925.70 Da Isoelectric Point: 9.8739
>T256678 WP_023993574.1 NZ_CP103791:c3965418-3965134 [Salmonella enterica subsp. enterica serovar Infantis]
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A623NIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A633LVJ8 |