Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2439122..2439644 | Replicon | chromosome |
Accession | NZ_CP103791 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NYQ90_RS11805 | Protein ID | WP_000221343.1 |
Coordinates | 2439122..2439406 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | NYQ90_RS11810 | Protein ID | WP_000885426.1 |
Coordinates | 2439396..2439644 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ90_RS11785 (2435201) | 2435201..2436709 | - | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
NYQ90_RS11790 (2436754) | 2436754..2437242 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NYQ90_RS11795 (2437435) | 2437435..2438514 | + | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NYQ90_RS11800 (2438562) | 2438562..2438951 | - | 390 | WP_023993262.1 | RidA family protein | - |
NYQ90_RS11805 (2439122) | 2439122..2439406 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYQ90_RS11810 (2439396) | 2439396..2439644 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NYQ90_RS11815 (2439796) | 2439796..2440011 | + | 216 | WP_023993263.1 | phage protein | - |
NYQ90_RS11820 (2440001) | 2440001..2440333 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
NYQ90_RS11825 (2440613) | 2440613..2440807 | + | 195 | Protein_2307 | hypothetical protein | - |
NYQ90_RS11830 (2440806) | 2440806..2441252 | - | 447 | Protein_2308 | helix-turn-helix domain-containing protein | - |
NYQ90_RS11835 (2442158) | 2442158..2443066 | + | 909 | WP_023994284.1 | LysR family transcriptional regulator | - |
NYQ90_RS11840 (2443240) | 2443240..2444220 | + | 981 | WP_023993266.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2433764..2445949 | 12185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T256673 WP_000221343.1 NZ_CP103791:c2439406-2439122 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |