Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1446339..1446959 | Replicon | chromosome |
Accession | NZ_CP103791 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NYQ90_RS06925 | Protein ID | WP_001280991.1 |
Coordinates | 1446339..1446557 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NYQ90_RS06930 | Protein ID | WP_000344807.1 |
Coordinates | 1446585..1446959 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ90_RS06885 (1441562) | 1441562..1442131 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
NYQ90_RS06890 (1442164) | 1442164..1442553 | - | 390 | WP_000961285.1 | MGMT family protein | - |
NYQ90_RS06900 (1442784) | 1442784..1444334 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
NYQ90_RS06905 (1444559) | 1444559..1444819 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NYQ90_RS06910 (1444825) | 1444825..1444965 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NYQ90_RS06915 (1445021) | 1445021..1445491 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NYQ90_RS06920 (1445609) | 1445609..1446160 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NYQ90_RS06925 (1446339) | 1446339..1446557 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NYQ90_RS06930 (1446585) | 1446585..1446959 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NYQ90_RS06935 (1447455) | 1447455..1450604 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NYQ90_RS06940 (1450627) | 1450627..1451820 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T256672 WP_001280991.1 NZ_CP103791:c1446557-1446339 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT256672 WP_000344807.1 NZ_CP103791:c1446959-1446585 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|