Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 310545..311131 | Replicon | chromosome |
| Accession | NZ_CP103791 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A5Y4K907 |
| Locus tag | NYQ90_RS01445 | Protein ID | WP_023202025.1 |
| Coordinates | 310763..311131 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | NYQ90_RS01440 | Protein ID | WP_023993856.1 |
| Coordinates | 310545..310766 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYQ90_RS01415 (305566) | 305566..306675 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NYQ90_RS01420 (306735) | 306735..307661 | + | 927 | WP_023183687.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NYQ90_RS01425 (307658) | 307658..308935 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| NYQ90_RS01430 (308932) | 308932..309699 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NYQ90_RS01435 (309701) | 309701..310414 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NYQ90_RS01440 (310545) | 310545..310766 | + | 222 | WP_023993856.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NYQ90_RS01445 (310763) | 310763..311131 | + | 369 | WP_023202025.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NYQ90_RS01450 (311390) | 311390..312706 | + | 1317 | WP_023993857.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NYQ90_RS01455 (312811) | 312811..313698 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NYQ90_RS01460 (313695) | 313695..314540 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NYQ90_RS01465 (314542) | 314542..315612 | + | 1071 | WP_000907846.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 307658..316349 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13703.01 Da Isoelectric Point: 6.7252
>T256667 WP_023202025.1 NZ_CP103791:310763-311131 [Salmonella enterica subsp. enterica serovar Infantis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|