Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310545..311131 Replicon chromosome
Accession NZ_CP103791
Organism Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712

Toxin (Protein)


Gene name doc Uniprot ID A0A5Y4K907
Locus tag NYQ90_RS01445 Protein ID WP_023202025.1
Coordinates 310763..311131 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag NYQ90_RS01440 Protein ID WP_023993856.1
Coordinates 310545..310766 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYQ90_RS01415 (305566) 305566..306675 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NYQ90_RS01420 (306735) 306735..307661 + 927 WP_023183687.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NYQ90_RS01425 (307658) 307658..308935 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NYQ90_RS01430 (308932) 308932..309699 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NYQ90_RS01435 (309701) 309701..310414 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NYQ90_RS01440 (310545) 310545..310766 + 222 WP_023993856.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NYQ90_RS01445 (310763) 310763..311131 + 369 WP_023202025.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NYQ90_RS01450 (311390) 311390..312706 + 1317 WP_023993857.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NYQ90_RS01455 (312811) 312811..313698 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NYQ90_RS01460 (313695) 313695..314540 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NYQ90_RS01465 (314542) 314542..315612 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307658..316349 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13703.01 Da        Isoelectric Point: 6.7252

>T256667 WP_023202025.1 NZ_CP103791:310763-311131 [Salmonella enterica subsp. enterica serovar Infantis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0637

>AT256667 WP_023993856.1 NZ_CP103791:310545-310766 [Salmonella enterica subsp. enterica serovar Infantis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRDLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y4K907

Antitoxin

Source ID Structure

References