Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1324933..1325849 | Replicon | chromosome |
| Accession | NZ_CP103784 | ||
| Organism | Bacillus subtilis strain RO-NN-1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | NYR91_RS06960 | Protein ID | WP_003244695.1 |
| Coordinates | 1325103..1325849 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | NYR91_RS06955 | Protein ID | WP_003232646.1 |
| Coordinates | 1324933..1325103 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR91_RS06920 (NYR91_06920) | 1321796..1322125 | + | 330 | WP_014476554.1 | XkdW family protein | - |
| NYR91_RS06925 (NYR91_06925) | 1322122..1322286 | + | 165 | WP_014476555.1 | XkdX family protein | - |
| NYR91_RS06930 (NYR91_06930) | 1322330..1323169 | + | 840 | WP_014476556.1 | phage-like element PBSX protein XepA | - |
| NYR91_RS06935 (NYR91_06935) | 1323222..1323491 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| NYR91_RS06940 (NYR91_06940) | 1323504..1323767 | + | 264 | WP_003232653.1 | phage holin | - |
| NYR91_RS06945 (NYR91_06945) | 1323780..1324673 | + | 894 | WP_014476557.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NYR91_RS06950 (NYR91_06950) | 1324710..1324847 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| NYR91_RS06955 (NYR91_06955) | 1324933..1325103 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| NYR91_RS06960 (NYR91_06960) | 1325103..1325849 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| NYR91_RS06965 (NYR91_06965) | 1325959..1326960 | - | 1002 | WP_014476558.1 | inorganic phosphate transporter | - |
| NYR91_RS06970 (NYR91_06970) | 1326973..1327590 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| NYR91_RS06975 (NYR91_06975) | 1327866..1329182 | - | 1317 | WP_014476559.1 | serine/threonine exchanger | - |
| NYR91_RS06980 (NYR91_06980) | 1329571..1330521 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
| NYR91_RS06985 (NYR91_06985) | 1330650..1330751 | + | 102 | Protein_1312 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T256665 WP_003244695.1 NZ_CP103784:c1325849-1325103 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|