Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 511936..512572 | Replicon | chromosome |
Accession | NZ_CP103784 | ||
Organism | Bacillus subtilis strain RO-NN-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NYR91_RS02605 | Protein ID | WP_003156187.1 |
Coordinates | 512222..512572 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NYR91_RS02600 | Protein ID | WP_003225183.1 |
Coordinates | 511936..512217 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR91_RS02580 (NYR91_02580) | 508296..508895 | - | 600 | WP_014475873.1 | rhomboid family intramembrane serine protease | - |
NYR91_RS02585 (NYR91_02585) | 508990..509355 | + | 366 | WP_014475874.1 | holo-ACP synthase | - |
NYR91_RS02590 (NYR91_02590) | 509521..510537 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
NYR91_RS02595 (NYR91_02595) | 510651..511820 | + | 1170 | WP_014475875.1 | alanine racemase | - |
NYR91_RS02600 (NYR91_02600) | 511936..512217 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NYR91_RS02605 (NYR91_02605) | 512222..512572 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NYR91_RS02610 (NYR91_02610) | 512689..513513 | + | 825 | WP_080009756.1 | RsbT co-antagonist protein RsbRA | - |
NYR91_RS02615 (NYR91_02615) | 513518..513883 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NYR91_RS02620 (NYR91_02620) | 513887..514288 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
NYR91_RS02625 (NYR91_02625) | 514300..515307 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NYR91_RS02630 (NYR91_02630) | 515376..515705 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
NYR91_RS02635 (NYR91_02635) | 515702..516184 | + | 483 | WP_014475878.1 | anti-sigma B factor RsbW | - |
NYR91_RS02640 (NYR91_02640) | 516150..516938 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NYR91_RS02645 (NYR91_02645) | 516938..517537 | + | 600 | WP_014475879.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256664 WP_003156187.1 NZ_CP103784:512222-512572 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|