Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1348021..1348937 | Replicon | chromosome |
Accession | NZ_CP103783 | ||
Organism | Bacillus subtilis subsp. subtilis str. 168 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NYR92_RS07100 | Protein ID | WP_003244695.1 |
Coordinates | 1348191..1348937 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NYR92_RS07095 | Protein ID | WP_003232646.1 |
Coordinates | 1348021..1348191 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR92_RS07060 (1344884) | 1344884..1345213 | + | 330 | WP_003232660.1 | XkdW family protein | - |
NYR92_RS07065 (1345210) | 1345210..1345374 | + | 165 | WP_003232658.1 | XkdX family protein | - |
NYR92_RS07070 (1345418) | 1345418..1346257 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
NYR92_RS07075 (1346310) | 1346310..1346579 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
NYR92_RS07080 (1346592) | 1346592..1346855 | + | 264 | WP_003232653.1 | phage holin | - |
NYR92_RS07085 (1346868) | 1346868..1347761 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
NYR92_RS07090 (1347798) | 1347798..1347935 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NYR92_RS07095 (1348021) | 1348021..1348191 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NYR92_RS07100 (1348191) | 1348191..1348937 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NYR92_RS07105 (1349047) | 1349047..1350048 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NYR92_RS07110 (1350061) | 1350061..1350678 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NYR92_RS07115 (1350954) | 1350954..1352270 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
NYR92_RS07120 (1352659) | 1352659..1353609 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
NYR92_RS07125 (1353710) | 1353710..1353856 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1314029..1413453 | 99424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T256644 WP_003244695.1 NZ_CP103783:c1348937-1348191 [Bacillus subtilis subsp. subtilis str. 168]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|