Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 518135..518771 | Replicon | chromosome |
| Accession | NZ_CP103783 | ||
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NYR92_RS02640 | Protein ID | WP_003156187.1 |
| Coordinates | 518421..518771 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | NYR92_RS02635 | Protein ID | WP_003225183.1 |
| Coordinates | 518135..518416 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS02615 (514494) | 514494..515093 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
| NYR92_RS02620 (515188) | 515188..515553 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
| NYR92_RS02625 (515719) | 515719..516735 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| NYR92_RS02630 (516850) | 516850..518019 | + | 1170 | WP_003234284.1 | alanine racemase | - |
| NYR92_RS02635 (518135) | 518135..518416 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NYR92_RS02640 (518421) | 518421..518771 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NYR92_RS02645 (518886) | 518886..519710 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| NYR92_RS02650 (519715) | 519715..520080 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| NYR92_RS02655 (520084) | 520084..520485 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| NYR92_RS02660 (520497) | 520497..521504 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| NYR92_RS02665 (521566) | 521566..521895 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| NYR92_RS02670 (521892) | 521892..522374 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| NYR92_RS02675 (522340) | 522340..523128 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| NYR92_RS02680 (523128) | 523128..523727 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256643 WP_003156187.1 NZ_CP103783:518421-518771 [Bacillus subtilis subsp. subtilis str. 168]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|