Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1310831..1311748 | Replicon | chromosome |
Accession | NZ_CP103782 | ||
Organism | Bacillus velezensis strain DA4 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NYR48_RS06925 | Protein ID | WP_259425380.1 |
Coordinates | 1311002..1311748 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NYR48_RS06920 | Protein ID | WP_003154807.1 |
Coordinates | 1310831..1311001 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR48_RS06880 | 1306055..1307686 | + | 1632 | WP_259425376.1 | pyocin knob domain-containing protein | - |
NYR48_RS06885 | 1307699..1308070 | + | 372 | WP_151296633.1 | XkdW family protein | - |
NYR48_RS06890 | 1308075..1308272 | + | 198 | WP_012117366.1 | XkdX family protein | - |
NYR48_RS06895 | 1308329..1309090 | + | 762 | WP_259425377.1 | phage portal protein | - |
NYR48_RS06900 | 1309142..1309405 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NYR48_RS06905 | 1309419..1309682 | + | 264 | WP_259425378.1 | phage holin | - |
NYR48_RS06910 | 1309696..1310574 | + | 879 | WP_043021264.1 | N-acetylmuramoyl-L-alanine amidase | - |
NYR48_RS06915 | 1310609..1310734 | - | 126 | WP_259425379.1 | hypothetical protein | - |
NYR48_RS06920 | 1310831..1311001 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NYR48_RS06925 | 1311002..1311748 | - | 747 | WP_259425380.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NYR48_RS06930 | 1311853..1312851 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NYR48_RS06935 | 1312864..1313481 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NYR48_RS06940 | 1313767..1315083 | - | 1317 | WP_259425381.1 | amino acid permease | - |
NYR48_RS06945 | 1315406..1316356 | + | 951 | WP_259425382.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29107.60 Da Isoelectric Point: 4.7755
>T256642 WP_259425380.1 NZ_CP103782:c1311748-1311002 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLTAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLTAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|