Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 479684..480321 | Replicon | chromosome |
Accession | NZ_CP103782 | ||
Organism | Bacillus velezensis strain DA4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NYR48_RS02450 | Protein ID | WP_003156187.1 |
Coordinates | 479971..480321 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NYR48_RS02445 | Protein ID | WP_003156188.1 |
Coordinates | 479684..479965 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR48_RS02425 | 476049..476648 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NYR48_RS02430 | 476741..477106 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
NYR48_RS02435 | 477271..478278 | + | 1008 | WP_259425004.1 | outer membrane lipoprotein carrier protein LolA | - |
NYR48_RS02440 | 478395..479564 | + | 1170 | WP_259425005.1 | alanine racemase | - |
NYR48_RS02445 | 479684..479965 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NYR48_RS02450 | 479971..480321 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NYR48_RS02455 | 480439..481260 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NYR48_RS02460 | 481265..481630 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NYR48_RS02465 | 481633..482034 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NYR48_RS02470 | 482046..483053 | + | 1008 | WP_259425006.1 | PP2C family protein-serine/threonine phosphatase | - |
NYR48_RS02475 | 483117..483446 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NYR48_RS02480 | 483443..483925 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NYR48_RS02485 | 483891..484679 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NYR48_RS02490 | 484679..485281 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256641 WP_003156187.1 NZ_CP103782:479971-480321 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|