Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2409524..2410502 | Replicon | chromosome |
Accession | NZ_CP103777 | ||
Organism | Bacillus toyonensis strain DC11 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | K0FNW8 |
Locus tag | NYR47_RS12330 | Protein ID | WP_000155917.1 |
Coordinates | 2409524..2410264 (+) | Length | 247 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NYR47_RS12335 | Protein ID | WP_142311449.1 |
Coordinates | 2410377..2410502 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR47_RS12310 | 2405186..2405968 | + | 783 | WP_097954109.1 | class I SAM-dependent methyltransferase | - |
NYR47_RS12315 | 2406147..2407823 | - | 1677 | WP_259417551.1 | alpha-keto acid decarboxylase family protein | - |
NYR47_RS12320 | 2407950..2408432 | + | 483 | WP_000196695.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NYR47_RS12325 | 2408600..2409337 | + | 738 | WP_259417552.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
NYR47_RS12330 | 2409524..2410264 | + | 741 | WP_000155917.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NYR47_RS12335 | 2410377..2410502 | + | 126 | WP_142311449.1 | D-alanyl-D-alanine carboxypeptidase | Antitoxin |
NYR47_RS12340 | 2410578..2410754 | + | 177 | WP_000808012.1 | stage II sporulation protein SB | - |
NYR47_RS12345 | 2410803..2411192 | - | 390 | Protein_2349 | YxeA family protein | - |
NYR47_RS12350 | 2411436..2412905 | + | 1470 | WP_000287513.1 | beta-Ala-His dipeptidase | - |
NYR47_RS12355 | 2413218..2414027 | + | 810 | WP_259417553.1 | papain-like cysteine protease family protein | - |
NYR47_RS12360 | 2414055..2414657 | + | 603 | WP_259417554.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28446.03 Da Isoelectric Point: 7.3946
>T256640 WP_000155917.1 NZ_CP103777:2409524-2410264 [Bacillus toyonensis]
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
MTISNIRIGLFILAIVFVVLVFFYWRNEELYEEKKQRIRKTWYGLFITSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIS
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTNIIQNINPAAFGTMEWHTEEEYTKSLNTFLDSYGEKIGAK
IVVFEAANELNTGFRGIRSQFSITIPIEHIEQLNEQKAVQVENVGIIPAKIMNDVFIVIDGKKNSLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|