Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 239859..240501 | Replicon | chromosome |
Accession | NZ_CP103777 | ||
Organism | Bacillus toyonensis strain DC11 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | NYR47_RS01370 | Protein ID | WP_000635963.1 |
Coordinates | 240151..240501 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | NYR47_RS01365 | Protein ID | WP_000004570.1 |
Coordinates | 239859..240146 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR47_RS01340 | 235186..236148 | + | 963 | WP_000961173.1 | UV DNA damage repair endonuclease UvsE | - |
NYR47_RS01345 | 236141..236713 | - | 573 | WP_000908504.1 | rhomboid family intramembrane serine protease | - |
NYR47_RS01350 | 236806..237165 | + | 360 | WP_000583421.1 | holo-ACP synthase | - |
NYR47_RS01355 | 237322..238272 | + | 951 | WP_002059179.1 | outer membrane lipoprotein carrier protein LolA | - |
NYR47_RS01360 | 238390..239559 | + | 1170 | WP_000390621.1 | alanine racemase | - |
NYR47_RS01365 | 239859..240146 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
NYR47_RS01370 | 240151..240501 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NYR47_RS01375 | 240570..242738 | + | 2169 | WP_000426215.1 | Tex family protein | - |
NYR47_RS01380 | 242797..242913 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
NYR47_RS01385 | 243121..243579 | + | 459 | WP_259416658.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T256639 WP_000635963.1 NZ_CP103777:240151-240501 [Bacillus toyonensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |