Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4497836..4498596 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A620G002 |
Locus tag | NYS49_RS21905 | Protein ID | WP_023138210.1 |
Coordinates | 4497836..4498321 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | Q8Z2B2 |
Locus tag | NYS49_RS21910 | Protein ID | WP_000965889.1 |
Coordinates | 4498309..4498596 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS21875 (4492898) | 4492898..4493560 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
NYS49_RS21880 (4493790) | 4493790..4494764 | + | 975 | WP_023138208.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
NYS49_RS21885 (4494814) | 4494814..4495524 | - | 711 | WP_023138209.1 | DUF3053 domain-containing protein | - |
NYS49_RS21890 (4495963) | 4495963..4496253 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
NYS49_RS21895 (4496541) | 4496541..4496753 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NYS49_RS21900 (4496926) | 4496926..4497465 | + | 540 | WP_000047148.1 | copper-binding periplasmic metallochaperone CueP | - |
NYS49_RS21905 (4497836) | 4497836..4498321 | - | 486 | WP_023138210.1 | GNAT family N-acetyltransferase | Toxin |
NYS49_RS21910 (4498309) | 4498309..4498596 | - | 288 | WP_000965889.1 | DUF1778 domain-containing protein | Antitoxin |
NYS49_RS21915 (4498808) | 4498808..4499053 | + | 246 | WP_023138211.1 | hypothetical protein | - |
NYS49_RS21920 (4499110) | 4499110..4499691 | + | 582 | WP_187791524.1 | hypothetical protein | - |
NYS49_RS21925 (4499735) | 4499735..4500517 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
NYS49_RS21930 (4500514) | 4500514..4501536 | - | 1023 | WP_000255946.1 | IS21-like element IS100 family transposase | - |
NYS49_RS21935 (4501934) | 4501934..4502271 | + | 338 | Protein_4284 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17643.31 Da Isoelectric Point: 9.8719
>T256633 WP_023138210.1 NZ_CP103771:c4498321-4497836 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSSHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSSHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A620G002 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752RW74 |