Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4321392..4321978 | Replicon | chromosome |
| Accession | NZ_CP103771 | ||
| Organism | Salmonella enterica strain S1905 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A5T2TYR8 |
| Locus tag | NYS49_RS21095 | Protein ID | WP_023138592.1 |
| Coordinates | 4321392..4321760 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | NYS49_RS21100 | Protein ID | WP_001520924.1 |
| Coordinates | 4321757..4321978 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYS49_RS21075 (4316911) | 4316911..4317981 | - | 1071 | WP_001646570.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| NYS49_RS21080 (4317983) | 4317983..4318828 | - | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NYS49_RS21085 (4318825) | 4318825..4319712 | - | 888 | WP_023138593.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NYS49_RS21090 (4319817) | 4319817..4321133 | - | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NYS49_RS21095 (4321392) | 4321392..4321760 | - | 369 | WP_023138592.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NYS49_RS21100 (4321757) | 4321757..4321978 | - | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NYS49_RS21105 (4322110) | 4322110..4322823 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NYS49_RS21110 (4322825) | 4322825..4323592 | - | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NYS49_RS21115 (4323589) | 4323589..4324866 | - | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| NYS49_RS21120 (4324863) | 4324863..4325789 | - | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NYS49_RS21125 (4325849) | 4325849..4326958 | - | 1110 | WP_000822977.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4316174..4324866 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13563.81 Da Isoelectric Point: 6.7252
>T256632 WP_023138592.1 NZ_CP103771:c4321760-4321392 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T2TYR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |