256632

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4321392..4321978 Replicon chromosome
Accession NZ_CP103771
Organism Salmonella enterica strain S1905

Toxin (Protein)


Gene name doc Uniprot ID A0A5T2TYR8
Locus tag NYS49_RS21095 Protein ID WP_023138592.1
Coordinates 4321392..4321760 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NYS49_RS21100 Protein ID WP_001520924.1
Coordinates 4321757..4321978 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYS49_RS21075 (4316911) 4316911..4317981 - 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NYS49_RS21080 (4317983) 4317983..4318828 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NYS49_RS21085 (4318825) 4318825..4319712 - 888 WP_023138593.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NYS49_RS21090 (4319817) 4319817..4321133 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NYS49_RS21095 (4321392) 4321392..4321760 - 369 WP_023138592.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NYS49_RS21100 (4321757) 4321757..4321978 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NYS49_RS21105 (4322110) 4322110..4322823 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NYS49_RS21110 (4322825) 4322825..4323592 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NYS49_RS21115 (4323589) 4323589..4324866 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NYS49_RS21120 (4324863) 4324863..4325789 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NYS49_RS21125 (4325849) 4325849..4326958 - 1110 WP_000822977.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4316174..4324866 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(25-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13563.81 Da        Isoelectric Point: 6.7252

>T256632 WP_023138592.1 NZ_CP103771:c4321760-4321392 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT256632 WP_001520924.1 NZ_CP103771:c4321978-4321757 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T2TYR8

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References