Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3793528..3794188 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NYS49_RS18440 | Protein ID | WP_000244756.1 |
Coordinates | 3793528..3793941 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NYS49_RS18445 | Protein ID | WP_000351186.1 |
Coordinates | 3793922..3794188 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS18420 (3789469) | 3789469..3791202 | - | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NYS49_RS18425 (3791208) | 3791208..3791921 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NYS49_RS18430 (3791945) | 3791945..3792841 | - | 897 | WP_000434303.1 | site-specific tyrosine recombinase XerD | - |
NYS49_RS18435 (3792954) | 3792954..3793475 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
NYS49_RS18440 (3793528) | 3793528..3793941 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
NYS49_RS18445 (3793922) | 3793922..3794188 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NYS49_RS18450 (3794438) | 3794438..3795418 | + | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
NYS49_RS18455 (3795534) | 3795534..3796193 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
NYS49_RS18460 (3796357) | 3796357..3796668 | - | 312 | WP_001182970.1 | N(4)-acetylcytidine aminohydrolase | - |
NYS49_RS18465 (3796827) | 3796827..3798260 | + | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T256631 WP_000244756.1 NZ_CP103771:c3793941-3793528 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |