Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3632688..3633502 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3G3DUX8 |
Locus tag | NYS49_RS17705 | Protein ID | WP_000971653.1 |
Coordinates | 3632975..3633502 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NYS49_RS17700 | Protein ID | WP_000855694.1 |
Coordinates | 3632688..3632978 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS17670 (3628629) | 3628629..3629279 | - | 651 | WP_023166786.1 | type III secretion system transcriptional activator InvF | - |
NYS49_RS17675 (3629736) | 3629736..3630179 | + | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NYS49_RS17680 (3630598) | 3630598..3631047 | + | 450 | WP_000381616.1 | hypothetical protein | - |
NYS49_RS17685 (3631032) | 3631032..3631379 | + | 348 | WP_001555786.1 | DUF1493 family protein | - |
NYS49_RS17690 (3631651) | 3631651..3631977 | - | 327 | WP_000393297.1 | hypothetical protein | - |
NYS49_RS17695 (3632218) | 3632218..3632418 | + | 201 | Protein_3453 | IS3 family transposase | - |
NYS49_RS17700 (3632688) | 3632688..3632978 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NYS49_RS17705 (3632975) | 3632975..3633502 | + | 528 | WP_000971653.1 | GNAT family N-acetyltransferase | Toxin |
NYS49_RS17710 (3633575) | 3633575..3633777 | - | 203 | Protein_3456 | IS5/IS1182 family transposase | - |
NYS49_RS17715 (3634127) | 3634127..3634783 | + | 657 | WP_000420449.1 | protein-serine/threonine phosphatase | - |
NYS49_RS17720 (3635028) | 3635028..3635522 | - | 495 | WP_000424947.1 | hypothetical protein | - |
NYS49_RS17725 (3635549) | 3635549..3636217 | - | 669 | WP_023137848.1 | hypothetical protein | - |
NYS49_RS17730 (3636374) | 3636374..3636592 | - | 219 | Protein_3460 | hypothetical protein | - |
NYS49_RS17735 (3636803) | 3636803..3637201 | - | 399 | Protein_3461 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3633575..3633715 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19043.87 Da Isoelectric Point: 9.7032
>T256630 WP_000971653.1 NZ_CP103771:3632975-3633502 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3DUX8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |