Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2232881..2233403 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NYS49_RS10805 | Protein ID | WP_000221345.1 |
Coordinates | 2232881..2233165 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NYS49_RS10810 | Protein ID | WP_000885424.1 |
Coordinates | 2233155..2233403 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS10785 (2228956) | 2228956..2230464 | - | 1509 | WP_023138146.1 | FAD-dependent oxidoreductase | - |
NYS49_RS10790 (2230509) | 2230509..2230997 | + | 489 | WP_023138147.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NYS49_RS10795 (2231190) | 2231190..2232263 | + | 1074 | WP_023138148.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NYS49_RS10800 (2232321) | 2232321..2232710 | - | 390 | WP_000194089.1 | RidA family protein | - |
NYS49_RS10805 (2232881) | 2232881..2233165 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYS49_RS10810 (2233155) | 2233155..2233403 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NYS49_RS10815 (2233816) | 2233816..2234169 | - | 354 | WP_000418733.1 | hypothetical protein | - |
NYS49_RS10820 (2234172) | 2234172..2234561 | - | 390 | WP_001044696.1 | hypothetical protein | - |
NYS49_RS10825 (2234926) | 2234926..2235033 | + | 108 | Protein_2111 | IS110 family transposase | - |
NYS49_RS10830 (2235440) | 2235440..2235772 | + | 333 | WP_023138149.1 | DUF1493 family protein | - |
NYS49_RS10835 (2236047) | 2236047..2236235 | - | 189 | WP_001276021.1 | DUF29 family protein | - |
NYS49_RS10840 (2236648) | 2236648..2237556 | + | 909 | WP_023138150.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2230509..2240428 | 9919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T256624 WP_000221345.1 NZ_CP103771:c2233165-2232881 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |