Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1213533..1214153 | Replicon | chromosome |
| Accession | NZ_CP103771 | ||
| Organism | Salmonella enterica strain S1905 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NYS49_RS05775 | Protein ID | WP_001280991.1 |
| Coordinates | 1213533..1213751 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NYS49_RS05780 | Protein ID | WP_000344807.1 |
| Coordinates | 1213779..1214153 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYS49_RS05735 (1208757) | 1208757..1209326 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
| NYS49_RS05740 (1209359) | 1209359..1209748 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| NYS49_RS05750 (1209979) | 1209979..1211529 | - | 1551 | WP_000213144.1 | EAL domain-containing protein | - |
| NYS49_RS05755 (1211754) | 1211754..1212014 | + | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
| NYS49_RS05760 (1212020) | 1212020..1212160 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NYS49_RS05765 (1212215) | 1212215..1212685 | - | 471 | WP_000136183.1 | YlaC family protein | - |
| NYS49_RS05770 (1212803) | 1212803..1213354 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NYS49_RS05775 (1213533) | 1213533..1213751 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NYS49_RS05780 (1213779) | 1213779..1214153 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NYS49_RS05785 (1214649) | 1214649..1217798 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NYS49_RS05790 (1217821) | 1217821..1219014 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T256623 WP_001280991.1 NZ_CP103771:c1213751-1213533 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT256623 WP_000344807.1 NZ_CP103771:c1214153-1213779 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|