Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 506032..506582 | Replicon | chromosome |
| Accession | NZ_CP103771 | ||
| Organism | Salmonella enterica strain S1905 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | NYS49_RS02455 | Protein ID | WP_001199743.1 |
| Coordinates | 506274..506582 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | NYS49_RS02450 | Protein ID | WP_001118105.1 |
| Coordinates | 506032..506271 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYS49_RS02405 (501081) | 501081..501284 | + | 204 | WP_023137300.1 | hypothetical protein | - |
| NYS49_RS02410 (501349) | 501349..502263 | + | 915 | WP_023138490.1 | hypothetical protein | - |
| NYS49_RS02415 (502348) | 502348..503169 | + | 822 | WP_023138491.1 | DUF932 domain-containing protein | - |
| NYS49_RS02420 (503182) | 503182..503682 | + | 501 | WP_023138492.1 | DNA repair protein RadC | - |
| NYS49_RS02425 (503679) | 503679..503900 | + | 222 | WP_023138493.1 | DUF987 family protein | - |
| NYS49_RS02430 (503923) | 503923..504264 | + | 342 | WP_023138494.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| NYS49_RS02435 (504308) | 504308..504649 | + | 342 | WP_023138495.1 | TA system toxin CbtA family protein | - |
| NYS49_RS02440 (504765) | 504765..505598 | + | 834 | WP_023138496.1 | DUF4942 domain-containing protein | - |
| NYS49_RS02445 (505675) | 505675..505923 | + | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
| NYS49_RS02450 (506032) | 506032..506271 | + | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NYS49_RS02455 (506274) | 506274..506582 | + | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| NYS49_RS02460 (506706) | 506706..507688 | - | 983 | Protein_473 | IS3 family transposase | - |
| NYS49_RS02465 (507755) | 507755..508772 | + | 1018 | Protein_474 | IS110 family transposase | - |
| NYS49_RS02470 (508998) | 508998..509114 | - | 117 | Protein_475 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T256621 WP_001199743.1 NZ_CP103771:506274-506582 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |