Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 503923..504649 Replicon chromosome
Accession NZ_CP103771
Organism Salmonella enterica strain S1905

Toxin (Protein)


Gene name ykfI Uniprot ID A0A5T2TVB7
Locus tag NYS49_RS02435 Protein ID WP_023138495.1
Coordinates 504308..504649 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A5T2TUW7
Locus tag NYS49_RS02430 Protein ID WP_023138494.1
Coordinates 503923..504264 (+) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYS49_RS02390 (499484) 499484..499777 + 294 WP_023138487.1 hypothetical protein -
NYS49_RS02395 (500132) 500132..500845 + 714 WP_023138489.1 WYL domain-containing protein -
NYS49_RS02400 (500918) 500918..501064 + 147 WP_023892166.1 hypothetical protein -
NYS49_RS02405 (501081) 501081..501284 + 204 WP_023137300.1 hypothetical protein -
NYS49_RS02410 (501349) 501349..502263 + 915 WP_023138490.1 hypothetical protein -
NYS49_RS02415 (502348) 502348..503169 + 822 WP_023138491.1 DUF932 domain-containing protein -
NYS49_RS02420 (503182) 503182..503682 + 501 WP_023138492.1 DNA repair protein RadC -
NYS49_RS02425 (503679) 503679..503900 + 222 WP_023138493.1 DUF987 family protein -
NYS49_RS02430 (503923) 503923..504264 + 342 WP_023138494.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NYS49_RS02435 (504308) 504308..504649 + 342 WP_023138495.1 TA system toxin CbtA family protein Toxin
NYS49_RS02440 (504765) 504765..505598 + 834 WP_023138496.1 DUF4942 domain-containing protein -
NYS49_RS02445 (505675) 505675..505923 + 249 WP_000168385.1 ribbon-helix-helix domain-containing protein -
NYS49_RS02450 (506032) 506032..506271 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin -
NYS49_RS02455 (506274) 506274..506582 + 309 WP_001199743.1 CcdB family protein -
NYS49_RS02460 (506706) 506706..507688 - 983 Protein_473 IS3 family transposase -
NYS49_RS02465 (507755) 507755..508772 + 1018 Protein_474 IS110 family transposase -
NYS49_RS02470 (508998) 508998..509114 - 117 Protein_475 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(2-109)

Antitoxin

Antitoxin CbeA

(11-109)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13132.05 Da        Isoelectric Point: 9.7617

>T256620 WP_023138495.1 NZ_CP103771:504308-504649 [Salmonella enterica]
MQTQYNHPHRATPSQLSPVEIWQKLLTHLLAKHYGLELSDTPFSVEKVIQEHIDAGITLANAVNFIVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRRQRYLAAH

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12690.40 Da        Isoelectric Point: 6.2121

>AT256620 WP_023138494.1 NZ_CP103771:503923-504264 [Salmonella enterica]
MDTNETQSTPVWGLRNDVFPSFGARLVQEGNHLHYLADRAGIYGEFTPAQLQTLDVVFPMFIKHMEAALRTGALNPREAR
RFTTELRGITCEADTCGSFGYVYLSLYPTIVKS

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T2TVB7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T2TUW7

References