Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 489948..490585 | Replicon | chromosome |
| Accession | NZ_CP103770 | ||
| Organism | Bacillus velezensis strain TH-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NYO93_RS02515 | Protein ID | WP_003156187.1 |
| Coordinates | 490235..490585 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | NYO93_RS02510 | Protein ID | WP_003156188.1 |
| Coordinates | 489948..490229 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO93_RS02490 (NYO93_02490) | 486313..486912 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
| NYO93_RS02495 (NYO93_02495) | 487005..487370 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| NYO93_RS02500 (NYO93_02500) | 487535..488542 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| NYO93_RS02505 (NYO93_02505) | 488659..489828 | + | 1170 | WP_032873001.1 | alanine racemase | - |
| NYO93_RS02510 (NYO93_02510) | 489948..490229 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NYO93_RS02515 (NYO93_02515) | 490235..490585 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NYO93_RS02520 (NYO93_02520) | 490703..491524 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| NYO93_RS02525 (NYO93_02525) | 491529..491894 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| NYO93_RS02530 (NYO93_02530) | 491897..492298 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| NYO93_RS02535 (NYO93_02535) | 492310..493317 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| NYO93_RS02540 (NYO93_02540) | 493381..493710 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| NYO93_RS02545 (NYO93_02545) | 493707..494189 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| NYO93_RS02550 (NYO93_02550) | 494155..494943 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| NYO93_RS02555 (NYO93_02555) | 494943..495545 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256617 WP_003156187.1 NZ_CP103770:490235-490585 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|