Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2642911..2643548 | Replicon | chromosome |
| Accession | NZ_CP103769 | ||
| Organism | Bacillus velezensis strain ML61 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NYR93_RS12575 | Protein ID | WP_003156187.1 |
| Coordinates | 2642911..2643261 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | NYR93_RS12580 | Protein ID | WP_003156188.1 |
| Coordinates | 2643267..2643548 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR93_RS12535 (NYR93_12540) | 2637951..2638553 | - | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
| NYR93_RS12540 (NYR93_12545) | 2638553..2639341 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| NYR93_RS12545 (NYR93_12550) | 2639307..2639789 | - | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| NYR93_RS12550 (NYR93_12555) | 2639786..2640115 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| NYR93_RS12555 (NYR93_12560) | 2640179..2641186 | - | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
| NYR93_RS12560 (NYR93_12565) | 2641198..2641599 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| NYR93_RS12565 (NYR93_12570) | 2641602..2641967 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| NYR93_RS12570 (NYR93_12575) | 2641972..2642793 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| NYR93_RS12575 (NYR93_12580) | 2642911..2643261 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NYR93_RS12580 (NYR93_12585) | 2643267..2643548 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NYR93_RS12585 (NYR93_12590) | 2643668..2644837 | - | 1170 | WP_003156189.1 | alanine racemase | - |
| NYR93_RS12590 (NYR93_12595) | 2644954..2645961 | - | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
| NYR93_RS12595 (NYR93_12600) | 2646126..2646491 | - | 366 | WP_003156192.1 | holo-ACP synthase | - |
| NYR93_RS12600 (NYR93_12605) | 2646584..2647183 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256616 WP_003156187.1 NZ_CP103769:c2643261-2642911 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|