Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1842064..1842981 | Replicon | chromosome |
Accession | NZ_CP103769 | ||
Organism | Bacillus velezensis strain ML61 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | NYR93_RS08630 | Protein ID | WP_003154806.1 |
Coordinates | 1842064..1842810 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NYR93_RS08635 | Protein ID | WP_003154807.1 |
Coordinates | 1842811..1842981 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR93_RS08610 (NYR93_08610) | 1837455..1838405 | - | 951 | WP_014304860.1 | ring-cleaving dioxygenase | - |
NYR93_RS08615 (NYR93_08615) | 1838729..1840045 | + | 1317 | WP_003154801.1 | amino acid permease | - |
NYR93_RS08620 (NYR93_08620) | 1840331..1840948 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NYR93_RS08625 (NYR93_08625) | 1840961..1841959 | + | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NYR93_RS08630 (NYR93_08630) | 1842064..1842810 | + | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NYR93_RS08635 (NYR93_08635) | 1842811..1842981 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NYR93_RS08640 (NYR93_08640) | 1843078..1843203 | + | 126 | WP_003154809.1 | hypothetical protein | - |
NYR93_RS08645 (NYR93_08645) | 1843239..1844117 | - | 879 | WP_014304858.1 | N-acetylmuramoyl-L-alanine amidase | - |
NYR93_RS08650 (NYR93_08650) | 1844131..1844394 | - | 264 | WP_003154813.1 | phage holin | - |
NYR93_RS08655 (NYR93_08655) | 1844408..1844671 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NYR93_RS08660 (NYR93_08660) | 1844723..1845484 | - | 762 | WP_046559521.1 | hypothetical protein | - |
NYR93_RS08665 (NYR93_08665) | 1845541..1845738 | - | 198 | WP_003154819.1 | XkdX family protein | - |
NYR93_RS08670 (NYR93_08670) | 1845744..1846115 | - | 372 | WP_014304856.1 | XkdW family protein | - |
NYR93_RS08675 (NYR93_08675) | 1846128..1847750 | - | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1833885..1876722 | 42837 | |
- | inside | Prophage | - | - | 1834148..1883649 | 49501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T256615 WP_003154806.1 NZ_CP103769:1842064-1842810 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8LGT8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |