Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3898462..3899279 | Replicon | chromosome |
| Accession | NZ_CP103768 | ||
| Organism | Morganella morganii strain K266 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | NYO97_RS18810 | Protein ID | WP_015422406.1 |
| Coordinates | 3898462..3898968 (-) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | J7TDK6 |
| Locus tag | NYO97_RS18815 | Protein ID | WP_004236533.1 |
| Coordinates | 3898971..3899279 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO97_RS18770 (NYO97_18770) | 3893821..3894444 | - | 624 | WP_004236525.1 | thiol:disulfide interchange protein DsbA | - |
| NYO97_RS18775 (NYO97_18775) | 3894463..3895458 | - | 996 | WP_004236526.1 | serine/threonine protein kinase | - |
| NYO97_RS18780 (NYO97_18780) | 3895458..3895727 | - | 270 | WP_004240741.1 | YihD family protein | - |
| NYO97_RS18785 (NYO97_18785) | 3895948..3896520 | + | 573 | Protein_3648 | molybdenum cofactor guanylyltransferase MobA | - |
| NYO97_RS18790 (NYO97_18790) | 3896527..3897045 | + | 519 | WP_223302449.1 | molybdopterin-guanine dinucleotide biosynthesis protein MobB | - |
| NYO97_RS18795 (NYO97_18795) | 3897260..3897562 | + | 303 | WP_004240743.1 | HdeA/HdeB family chaperone | - |
| NYO97_RS18800 (NYO97_18800) | 3897690..3898211 | + | 522 | WP_015422407.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NYO97_RS18805 (NYO97_18805) | 3898208..3898348 | + | 141 | WP_004236531.1 | hypothetical protein | - |
| NYO97_RS18810 (NYO97_18810) | 3898462..3898968 | - | 507 | WP_015422406.1 | GNAT family N-acetyltransferase | Toxin |
| NYO97_RS18815 (NYO97_18815) | 3898971..3899279 | - | 309 | WP_004236533.1 | DUF1778 domain-containing protein | Antitoxin |
| NYO97_RS18820 (NYO97_18820) | 3899411..3900763 | - | 1353 | WP_046024838.1 | glutathione-disulfide reductase | - |
| NYO97_RS18825 (NYO97_18825) | 3900833..3901675 | - | 843 | WP_259380451.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| NYO97_RS18830 (NYO97_18830) | 3901865..3902254 | + | 390 | WP_004236536.1 | DUF1090 domain-containing protein | - |
| NYO97_RS18835 (NYO97_18835) | 3902666..3903658 | + | 993 | WP_087825439.1 | inner membrane protein YhjD | - |
| NYO97_RS18840 (NYO97_18840) | 3903766..3903972 | + | 207 | WP_004236540.1 | 4-oxalocrotonate tautomerase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18565.43 Da Isoelectric Point: 9.9508
>T256614 WP_015422406.1 NZ_CP103768:c3898968-3898462 [Morganella morganii]
MNLTAPEPLQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPE
IPVILPGRLAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQ
LATGIYSE
MNLTAPEPLQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPE
IPVILPGRLAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQ
LATGIYSE
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|