Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 1..602 | Replicon | plasmid pMB9880_2 |
| Accession | NZ_CP103764 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | M5T11_RS25565 | Protein ID | WP_001216045.1 |
| Coordinates | 222..602 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | M5T11_RS25560 | Protein ID | WP_001190712.1 |
| Coordinates | 1..222 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS25560 (M5T11_25560) | 1..222 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5T11_RS25565 (M5T11_25565) | 222..602 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5T11_RS25570 (M5T11_25570) | 607..786 | + | 180 | WP_000113018.1 | hypothetical protein | - |
| M5T11_RS25575 (M5T11_25575) | 814..1857 | + | 1044 | WP_029393260.1 | DUF968 domain-containing protein | - |
| M5T11_RS25580 (M5T11_25580) | 1946..2398 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
| M5T11_RS25585 (M5T11_25585) | 2484..3677 | + | 1194 | WP_060578234.1 | hypothetical protein | - |
| M5T11_RS25590 (M5T11_25590) | 3677..5161 | + | 1485 | WP_000124159.1 | hypothetical protein | - |
| M5T11_RS25595 (M5T11_25595) | 5375..5476 | + | 102 | Protein_7 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97212 | 97212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T256611 WP_001216045.1 NZ_CP103764:222-602 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |