Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 113837..114480 | Replicon | plasmid pMB9880_1 |
| Accession | NZ_CP103763 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | M5T11_RS25495 | Protein ID | WP_001044768.1 |
| Coordinates | 114064..114480 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | M5T11_RS25490 | Protein ID | WP_001261287.1 |
| Coordinates | 113837..114067 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS25480 (109015) | 109015..110148 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| M5T11_RS25485 (110411) | 110411..113530 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
| M5T11_RS25490 (113837) | 113837..114067 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5T11_RS25495 (114064) | 114064..114480 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T11_RS25500 (114642) | 114642..116780 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
| M5T11_RS25505 (117245) | 117245..118240 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| M5T11_RS25510 (118283) | 118283..119176 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..128773 | 128773 | |
| - | flank | IS/Tn | - | - | 119313..119816 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T256610 WP_001044768.1 NZ_CP103763:114064-114480 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |