Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 107358..107883 | Replicon | plasmid pMB9880_1 |
| Accession | NZ_CP103763 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | M5T11_RS25460 | Protein ID | WP_001159868.1 |
| Coordinates | 107358..107663 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A223LLB0 |
| Locus tag | M5T11_RS25465 | Protein ID | WP_023909027.1 |
| Coordinates | 107665..107883 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS25445 (103268) | 103268..104434 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| M5T11_RS25450 (105022) | 105022..105777 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| M5T11_RS25455 (106551) | 106551..107357 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| M5T11_RS25460 (107358) | 107358..107663 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M5T11_RS25465 (107665) | 107665..107883 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M5T11_RS25470 (108517) | 108517..108714 | + | 198 | WP_000215657.1 | hypothetical protein | - |
| M5T11_RS25475 (108711) | 108711..108995 | - | 285 | WP_000642771.1 | hypothetical protein | - |
| M5T11_RS25480 (109015) | 109015..110148 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..128773 | 128773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T256609 WP_001159868.1 NZ_CP103763:c107663-107358 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|