Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4619669..4620504 | Replicon | chromosome |
| Accession | NZ_CP103762 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J1YPH7 |
| Locus tag | M5T11_RS22500 | Protein ID | WP_029701676.1 |
| Coordinates | 4620127..4620504 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K5N986 |
| Locus tag | M5T11_RS22495 | Protein ID | WP_021553056.1 |
| Coordinates | 4619669..4620037 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS22460 (4615331) | 4615331..4616011 | + | 681 | WP_029702103.1 | WYL domain-containing protein | - |
| M5T11_RS22465 (4616159) | 4616159..4616836 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| M5T11_RS22470 (4616842) | 4616842..4617075 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| M5T11_RS22475 (4617165) | 4617165..4617983 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M5T11_RS22480 (4618249) | 4618249..4618728 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| M5T11_RS22485 (4618744) | 4618744..4619220 | + | 477 | WP_021553055.1 | RadC family protein | - |
| M5T11_RS22490 (4619285) | 4619285..4619506 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T11_RS22495 (4619669) | 4619669..4620037 | + | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T11_RS22500 (4620127) | 4620127..4620504 | + | 378 | WP_029701676.1 | TA system toxin CbtA family protein | Toxin |
| M5T11_RS22505 (4620501) | 4620501..4620650 | + | 150 | Protein_4405 | DUF5983 family protein | - |
| M5T11_RS22510 (4620729) | 4620729..4620923 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| M5T11_RS22515 (4621008) | 4621008..4621850 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| M5T11_RS22520 (4622599) | 4622599..4624137 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14066.04 Da Isoelectric Point: 7.8045
>T256602 WP_029701676.1 NZ_CP103762:4620127-4620504 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT256602 WP_021553056.1 NZ_CP103762:4619669-4620037 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1YPH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5N986 |