Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4447466..4447988 | Replicon | chromosome |
Accession | NZ_CP103762 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | M5T11_RS21560 | Protein ID | WP_001105433.1 |
Coordinates | 4447466..4447756 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | M5T11_RS21565 | Protein ID | WP_000212715.1 |
Coordinates | 4447746..4447988 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS21545 (4442629) | 4442629..4444284 | + | 1656 | WP_021523332.1 | alpha,alpha-phosphotrehalase | - |
M5T11_RS21550 (4444678) | 4444678..4446816 | + | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5T11_RS21555 (4447001) | 4447001..4447465 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5T11_RS21560 (4447466) | 4447466..4447756 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T11_RS21565 (4447746) | 4447746..4447988 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5T11_RS21570 (4448180) | 4448180..4448566 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
M5T11_RS21575 (4448750) | 4448750..4450102 | - | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
M5T11_RS21580 (4450196) | 4450196..4450747 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
M5T11_RS21585 (4450899) | 4450899..4452272 | - | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T256600 WP_001105433.1 NZ_CP103762:c4447756-4447466 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |