Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4341364..4342178 | Replicon | chromosome |
Accession | NZ_CP103762 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M5T11_RS21010 | Protein ID | WP_001054376.1 |
Coordinates | 4341364..4341621 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | M5T11_RS21015 | Protein ID | WP_001309181.1 |
Coordinates | 4341633..4342178 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS20985 (4336652) | 4336652..4337758 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
M5T11_RS20990 (4337823) | 4337823..4338803 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M5T11_RS20995 (4338913) | 4338913..4339118 | + | 206 | Protein_4108 | HNH endonuclease | - |
M5T11_RS21000 (4339386) | 4339386..4340626 | - | 1241 | Protein_4109 | helicase YjhR | - |
M5T11_RS21005 (4340742) | 4340742..4340873 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M5T11_RS21010 (4341364) | 4341364..4341621 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M5T11_RS21015 (4341633) | 4341633..4342178 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
M5T11_RS21020 (4342234) | 4342234..4342980 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M5T11_RS21025 (4343149) | 4343149..4343367 | + | 219 | Protein_4114 | hypothetical protein | - |
M5T11_RS21030 (4343405) | 4343405..4343521 | + | 117 | Protein_4115 | VOC family protein | - |
M5T11_RS21035 (4343766) | 4343766..4344887 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M5T11_RS21040 (4344884) | 4344884..4345162 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M5T11_RS21045 (4345174) | 4345174..4346487 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4333858..4350402 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T256599 WP_001054376.1 NZ_CP103762:4341364-4341621 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT256599 WP_001309181.1 NZ_CP103762:4341633-4342178 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|