Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3311754..3312459 | Replicon | chromosome |
Accession | NZ_CP103762 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5T11_RS16300 | Protein ID | WP_000539521.1 |
Coordinates | 3311754..3312140 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5T11_RS16305 | Protein ID | WP_001280945.1 |
Coordinates | 3312130..3312459 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS16280 (3307758) | 3307758..3308384 | + | 627 | WP_020233670.1 | glutathione S-transferase GstB | - |
M5T11_RS16285 (3308381) | 3308381..3309496 | - | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
M5T11_RS16290 (3309607) | 3309607..3309990 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5T11_RS16295 (3310203) | 3310203..3311528 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5T11_RS16300 (3311754) | 3311754..3312140 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T11_RS16305 (3312130) | 3312130..3312459 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5T11_RS16310 (3312529) | 3312529..3313857 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
M5T11_RS16315 (3313865) | 3313865..3316213 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
M5T11_RS16320 (3316391) | 3316391..3317302 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T256595 WP_000539521.1 NZ_CP103762:3311754-3312140 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|