Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3056149..3056933 | Replicon | chromosome |
Accession | NZ_CP103762 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | M5T11_RS15095 | Protein ID | WP_000613626.1 |
Coordinates | 3056439..3056933 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | M5T11_RS15090 | Protein ID | WP_001110447.1 |
Coordinates | 3056149..3056442 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS15080 (3051299) | 3051299..3052258 | - | 960 | WP_000846343.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
M5T11_RS15085 (3052831) | 3052831..3056016 | + | 3186 | WP_001522867.1 | ribonuclease E | - |
M5T11_RS15090 (3056149) | 3056149..3056442 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
M5T11_RS15095 (3056439) | 3056439..3056933 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
M5T11_RS15100 (3057028) | 3057028..3057981 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
M5T11_RS15105 (3057993) | 3057993..3059636 | - | 1644 | WP_001522865.1 | flagellar hook-associated protein FlgK | - |
M5T11_RS15110 (3059702) | 3059702..3060643 | - | 942 | WP_001522863.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M5T11_RS15115 (3060643) | 3060643..3061740 | - | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T256594 WP_000613626.1 NZ_CP103762:3056439-3056933 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|