Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2617771..2618409 | Replicon | chromosome |
| Accession | NZ_CP103762 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0D8WF76 |
| Locus tag | M5T11_RS12790 | Protein ID | WP_001306887.1 |
| Coordinates | 2618233..2618409 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T11_RS12785 | Protein ID | WP_001270286.1 |
| Coordinates | 2617771..2618187 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS12765 (2612923) | 2612923..2613864 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| M5T11_RS12770 (2613865) | 2613865..2614878 | - | 1014 | WP_001523231.1 | ABC transporter ATP-binding protein | - |
| M5T11_RS12775 (2614896) | 2614896..2616041 | - | 1146 | WP_020233879.1 | ABC transporter substrate-binding protein | - |
| M5T11_RS12780 (2616286) | 2616286..2617692 | - | 1407 | WP_001523229.1 | PLP-dependent aminotransferase family protein | - |
| M5T11_RS12785 (2617771) | 2617771..2618187 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T11_RS12790 (2618233) | 2618233..2618409 | - | 177 | WP_001306887.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T11_RS12795 (2618631) | 2618631..2618861 | + | 231 | WP_000494241.1 | YncJ family protein | - |
| M5T11_RS12800 (2618953) | 2618953..2620914 | - | 1962 | WP_024166512.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T11_RS12805 (2620987) | 2620987..2621523 | - | 537 | WP_020233877.1 | DNA-binding transcriptional regulator SutR | - |
| M5T11_RS12810 (2621615) | 2621615..2622787 | + | 1173 | WP_001523225.1 | BenE family transporter YdcO | - |
| M5T11_RS12815 (2622895) | 2622895..2623353 | - | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2622895..2623353 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6768.88 Da Isoelectric Point: 11.5336
>T256593 WP_001306887.1 NZ_CP103762:c2618409-2618233 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256593 WP_001270286.1 NZ_CP103762:c2618187-2617771 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|