Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 824159..824994 Replicon chromosome
Accession NZ_CP103762
Organism Escherichia coli strain 5283

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag M5T11_RS03930 Protein ID WP_021543420.1
Coordinates 824159..824536 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID Q5I3J0
Locus tag M5T11_RS03935 Protein ID WP_001280951.1
Coordinates 824626..824994 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T11_RS03900 (819286) 819286..820434 - 1149 WP_000905922.1 capsule polysaccharide export inner-membrane protein KpsE -
M5T11_RS03905 (820506) 820506..821489 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
M5T11_RS03910 (822300) 822300..822470 - 171 Protein_767 IS110 family transposase -
M5T11_RS03915 (822813) 822813..823655 - 843 WP_001290171.1 DUF4942 domain-containing protein -
M5T11_RS03920 (823740) 823740..823937 - 198 WP_086795284.1 DUF957 domain-containing protein -
M5T11_RS03925 (824013) 824013..824162 - 150 Protein_770 DUF5983 family protein -
M5T11_RS03930 (824159) 824159..824536 - 378 WP_021543420.1 TA system toxin CbtA family protein Toxin
M5T11_RS03935 (824626) 824626..824994 - 369 WP_001280951.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T11_RS03940 (825157) 825157..825378 - 222 WP_001405861.1 DUF987 domain-containing protein -
M5T11_RS03945 (825447) 825447..825923 - 477 WP_001186724.1 RadC family protein -
M5T11_RS03950 (825939) 825939..826424 - 486 WP_000213717.1 antirestriction protein -
M5T11_RS03955 (826501) 826501..827319 - 819 WP_001175170.1 DUF932 domain-containing protein -
M5T11_RS03960 (827409) 827409..827642 - 234 WP_001278288.1 DUF905 family protein -
M5T11_RS03965 (827648) 827648..828325 - 678 WP_001097362.1 hypothetical protein -
M5T11_RS03970 (828444) 828444..829328 - 885 WP_000010399.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13975.96 Da        Isoelectric Point: 8.2905

>T256582 WP_021543420.1 NZ_CP103762:c824536-824159 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13699.56 Da        Isoelectric Point: 7.0268

>AT256582 WP_001280951.1 NZ_CP103762:c824994-824626 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q5I3J0

References