Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 21104..21747 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103759 | ||
| Organism | Escherichia coli strain p10B | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NYO15_RS23295 | Protein ID | WP_001044768.1 |
| Coordinates | 21331..21747 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NYO15_RS23290 | Protein ID | WP_001261287.1 |
| Coordinates | 21104..21334 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO15_RS23270 (16264) | 16264..17352 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| NYO15_RS23275 (17354) | 17354..19579 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| NYO15_RS23280 (19629) | 19629..20528 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| NYO15_RS23285 (20518) | 20518..20808 | - | 291 | WP_000111771.1 | hypothetical protein | - |
| NYO15_RS23290 (21104) | 21104..21334 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NYO15_RS23295 (21331) | 21331..21747 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYO15_RS23300 (21909) | 21909..24047 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
| NYO15_RS23305 (24401) | 24401..24658 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| NYO15_RS23310 (24658) | 24658..25248 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / aph(3')-Ia / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132213 | 132213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T256574 WP_001044768.1 NZ_CP103759:21331-21747 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |