Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 59582..60129 Replicon plasmid unnamed2
Accession NZ_CP103757
Organism Escherichia coli strain p11B

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NYO14_RS27670 Protein ID WP_001384452.1
Coordinates 59851..60129 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID K4JYR0
Locus tag NYO14_RS27665 Protein ID WP_000079928.1
Coordinates 59582..59851 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO14_RS27625 (54900) 54900..55361 + 462 WP_016230918.1 thermonuclease family protein -
NYO14_RS27630 (55407) 55407..55616 + 210 WP_001369435.1 hemolysin expression modulator Hha -
NYO14_RS27635 (55654) 55654..55881 + 228 Protein_73 hypothetical protein -
NYO14_RS27645 (56652) 56652..57020 + 369 Protein_75 DUF2726 domain-containing protein -
NYO14_RS27650 (57260) 57260..57520 + 261 WP_000083819.1 replication regulatory protein RepA -
NYO14_RS27655 (57744) 57744..57818 + 75 WP_001365705.1 RepA leader peptide Tap -
NYO14_RS27660 (57811) 57811..58668 + 858 WP_042018306.1 incFII family plasmid replication initiator RepA -
NYO14_RS27665 (59582) 59582..59851 + 270 WP_000079928.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NYO14_RS27670 (59851) 59851..60129 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NYO14_RS27675 (60175) 60175..61023 + 849 WP_016235419.1 3'-5' exonuclease -
NYO14_RS27680 (61140) 61140..61622 + 483 WP_001311056.1 hypothetical protein -
NYO14_RS27685 (61982) 61982..63169 - 1188 Protein_83 IS91 family transposase -
NYO14_RS27690 (63169) 63169..63534 - 366 WP_016235422.1 hypothetical protein -
NYO14_RS27695 (64062) 64062..64571 + 510 WP_000115001.1 peptide deformylase -
NYO14_RS27700 (64586) 64586..64687 + 102 Protein_86 methionyl-tRNA formyltransferase -
NYO14_RS27705 (64884) 64884..65075 + 192 WP_000175572.1 DUF2164 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..70739 70739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T256557 WP_001384452.1 NZ_CP103757:59851-60129 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10175.50 Da        Isoelectric Point: 7.3210

>AT256557 WP_000079928.1 NZ_CP103757:59582-59851 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A5W2J4D0

References