Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 176369..176894 Replicon plasmid unnamed1
Accession NZ_CP103756
Organism Escherichia coli strain p11B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NYO14_RS27245 Protein ID WP_001159871.1
Coordinates 176589..176894 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NYO14_RS27240 Protein ID WP_000813630.1
Coordinates 176369..176587 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO14_RS27205 (172796) 172796..173119 + 324 Protein_200 helix-turn-helix domain-containing protein -
NYO14_RS27210 (173121) 173121..173225 + 105 Protein_201 AAA family ATPase -
NYO14_RS27215 (173286) 173286..173799 + 514 Protein_202 DUF4113 domain-containing protein -
NYO14_RS27225 (174732) 174732..175091 - 360 Protein_204 ATP-binding protein -
NYO14_RS27230 (175166) 175166..175582 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
NYO14_RS27235 (175579) 175579..175809 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NYO14_RS27240 (176369) 176369..176587 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NYO14_RS27245 (176589) 176589..176894 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NYO14_RS27250 (176895) 176895..177701 + 807 WP_000016970.1 site-specific integrase -
NYO14_RS27255 (178042) 178042..179655 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
NYO14_RS27260 (179686) 179686..180036 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
NYO14_RS27265 (180033) 180033..180458 - 426 WP_000422741.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 senB 1..180962 180962
- inside IScluster/Tn - - 172796..180458 7662


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T256556 WP_001159871.1 NZ_CP103756:176589-176894 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT256556 WP_000813630.1 NZ_CP103756:176369-176587 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References