Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 175166..175809 Replicon plasmid unnamed1
Accession NZ_CP103756
Organism Escherichia coli strain p11B

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag NYO14_RS27230 Protein ID WP_001034044.1
Coordinates 175166..175582 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag NYO14_RS27235 Protein ID WP_001261286.1
Coordinates 175579..175809 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO14_RS27200 (171073) 171073..172050 - 978 WP_000361611.1 RepB family plasmid replication initiator protein -
NYO14_RS27205 (172796) 172796..173119 + 324 Protein_200 helix-turn-helix domain-containing protein -
NYO14_RS27210 (173121) 173121..173225 + 105 Protein_201 AAA family ATPase -
NYO14_RS27215 (173286) 173286..173799 + 514 Protein_202 DUF4113 domain-containing protein -
NYO14_RS27225 (174732) 174732..175091 - 360 Protein_204 ATP-binding protein -
NYO14_RS27230 (175166) 175166..175582 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
NYO14_RS27235 (175579) 175579..175809 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NYO14_RS27240 (176369) 176369..176587 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NYO14_RS27245 (176589) 176589..176894 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NYO14_RS27250 (176895) 176895..177701 + 807 WP_000016970.1 site-specific integrase -
NYO14_RS27255 (178042) 178042..179655 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
NYO14_RS27260 (179686) 179686..180036 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
NYO14_RS27265 (180033) 180033..180458 - 426 WP_000422741.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 senB 1..180962 180962
- inside IScluster/Tn - - 172796..180458 7662


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T256555 WP_001034044.1 NZ_CP103756:c175582-175166 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT256555 WP_001261286.1 NZ_CP103756:c175809-175579 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References