Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1984927..1985758 Replicon chromosome
Accession NZ_CP103755
Organism Escherichia coli strain p11B

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NYO14_RS09585 Protein ID WP_165696580.1
Coordinates 1984927..1985301 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag NYO14_RS09590 Protein ID WP_001280918.1
Coordinates 1985390..1985758 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO14_RS09545 (1980323) 1980323..1981489 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NYO14_RS09550 (1981608) 1981608..1982081 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
NYO14_RS09555 (1982279) 1982279..1983337 + 1059 WP_001200889.1 FUSC family protein -
NYO14_RS09560 (1983509) 1983509..1983838 + 330 WP_000450409.1 DUF496 family protein -
NYO14_RS09565 (1983939) 1983939..1984262 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
NYO14_RS09570 (1984241) 1984241..1984321 + 81 WP_023441679.1 hypothetical protein -
NYO14_RS09575 (1984610) 1984610..1984690 - 81 Protein_1878 hypothetical protein -
NYO14_RS09580 (1984736) 1984736..1984930 - 195 WP_000988600.1 DUF5983 family protein -
NYO14_RS09585 (1984927) 1984927..1985301 - 375 WP_165696580.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NYO14_RS09590 (1985390) 1985390..1985758 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NYO14_RS09595 (1985774) 1985774..1986418 - 645 WP_000086752.1 hypothetical protein -
NYO14_RS09600 (1986437) 1986437..1986658 - 222 WP_000692345.1 DUF987 domain-containing protein -
NYO14_RS09605 (1986721) 1986721..1987197 - 477 WP_001186200.1 RadC family protein -
NYO14_RS09610 (1987213) 1987213..1987686 - 474 WP_001542276.1 antirestriction protein -
NYO14_RS09615 (1987780) 1987780..1988025 - 246 WP_001164966.1 hypothetical protein -
NYO14_RS09620 (1988025) 1988025..1988843 - 819 WP_001542275.1 DUF932 domain-containing protein -
NYO14_RS09625 (1989064) 1989064..1989474 - 411 WP_000846703.1 hypothetical protein -
NYO14_RS09630 (1989490) 1989490..1989840 - 351 Protein_1889 hypothetical protein -
NYO14_RS09635 (1989923) 1989923..1990669 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1938276..1994861 56585
- inside Prophage - - 1936701..1994861 58160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13813.79 Da        Isoelectric Point: 7.1326

>T256532 WP_165696580.1 NZ_CP103755:c1985301-1984927 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDIPRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT256532 WP_001280918.1 NZ_CP103755:c1985758-1985390 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References