Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 952307..952961 | Replicon | chromosome |
Accession | NZ_CP103755 | ||
Organism | Escherichia coli strain p11B |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | NYO14_RS04715 | Protein ID | WP_000244765.1 |
Coordinates | 952554..952961 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | NYO14_RS04710 | Protein ID | WP_000354050.1 |
Coordinates | 952307..952573 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO14_RS04690 (948395) | 948395..949828 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
NYO14_RS04695 (949873) | 949873..950184 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
NYO14_RS04700 (950348) | 950348..951007 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
NYO14_RS04705 (951084) | 951084..952064 | - | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
NYO14_RS04710 (952307) | 952307..952573 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
NYO14_RS04715 (952554) | 952554..952961 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
NYO14_RS04720 (953001) | 953001..953522 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NYO14_RS04725 (953634) | 953634..954530 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NYO14_RS04730 (954555) | 954555..955265 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NYO14_RS04735 (955271) | 955271..957004 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T256530 WP_000244765.1 NZ_CP103755:952554-952961 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |