Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 111959..112602 | Replicon | plasmid pMB2791_1 |
Accession | NZ_CP103746 | ||
Organism | Escherichia coli strain 3090 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | M5T02_RS24300 | Protein ID | WP_001044768.1 |
Coordinates | 112186..112602 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | M5T02_RS24295 | Protein ID | WP_001261287.1 |
Coordinates | 111959..112189 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T02_RS24275 (107139) | 107139..108272 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
M5T02_RS24280 (108535) | 108535..110172 | - | 1638 | WP_223201785.1 | hypothetical protein | - |
M5T02_RS24285 (110223) | 110223..111053 | - | 831 | WP_223201786.1 | hypothetical protein | - |
M5T02_RS24290 (111105) | 111105..111653 | - | 549 | WP_039002808.1 | hypothetical protein | - |
M5T02_RS24295 (111959) | 111959..112189 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5T02_RS24300 (112186) | 112186..112602 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T02_RS24305 (112764) | 112764..114902 | - | 2139 | WP_039002805.1 | AAA family ATPase | - |
M5T02_RS24310 (115367) | 115367..116362 | + | 996 | WP_000246636.1 | hypothetical protein | - |
M5T02_RS24315 (116405) | 116405..117298 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 117435..117938 | 503 | |
- | inside | Conjugative plasmid | ant(3'')-Ia / lnu(F) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / tet(M) / aac(3)-IId | - | 1..120324 | 120324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T256501 WP_001044768.1 NZ_CP103746:112186-112602 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |