Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 37284..37819 Replicon plasmid pMB2791_1
Accession NZ_CP103746
Organism Escherichia coli strain 3090

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag M5T02_RS23845 Protein ID WP_000222766.1
Coordinates 37284..37571 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag M5T02_RS23850 Protein ID WP_001132900.1
Coordinates 37568..37819 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T02_RS23815 (32832) 32832..33692 - 861 WP_000557454.1 aminoglycoside N-acetyltransferase AAC(3)-IId -
M5T02_RS23820 (33835) 33835..34329 + 495 Protein_38 IS4-like element ISVsa5 family transposase -
M5T02_RS23825 (34383) 34383..35087 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
M5T02_RS23830 (35155) 35155..36453 + 1299 Protein_40 Tn3-like element Tn3 family transposase -
M5T02_RS23835 (36487) 36487..36987 + 501 Protein_41 Tn3 family transposase -
M5T02_RS23840 (37021) 37021..37209 + 189 Protein_42 IS3 family transposase -
M5T02_RS23845 (37284) 37284..37571 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5T02_RS23850 (37568) 37568..37819 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T02_RS23855 (38785) 38785..39642 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
M5T02_RS23860 (39635) 39635..39709 - 75 WP_061357229.1 RepA leader peptide Tap -
M5T02_RS23865 (39941) 39941..40198 - 258 WP_001541895.1 replication regulatory protein RepA -
M5T02_RS23870 (40466) 40466..40615 - 150 WP_001312851.1 Hok/Gef family protein -
- (40659) 40659..40720 + 62 NuclAT_1 - -
- (40659) 40659..40720 + 62 NuclAT_1 - -
- (40659) 40659..40720 + 62 NuclAT_1 - -
- (40659) 40659..40720 + 62 NuclAT_1 - -
M5T02_RS23875 (41062) 41062..41274 - 213 WP_001541896.1 ANR family transcriptional regulator -
M5T02_RS23880 (41409) 41409..41969 - 561 WP_000139310.1 fertility inhibition protein FinO -
M5T02_RS23885 (42024) 42024..42767 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / lnu(F) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / tet(M) / aac(3)-IId - 1..120324 120324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T256493 WP_000222766.1 NZ_CP103746:c37571-37284 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT256493 WP_001132900.1 NZ_CP103746:c37819-37568 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References